Lineage for d1k7ka_ (1k7k A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1856157Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 1856374Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 1856375Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 1856376Protein Hypothetical protein YggV [75242] (1 species)
    annotated as putative ribosomal protein
  7. 1856377Species Escherichia coli [TaxId:562] [75243] (1 PDB entry)
  8. 1856378Domain d1k7ka_: 1k7k A: [72104]

Details for d1k7ka_

PDB Entry: 1k7k (more details), 1.5 Å

PDB Description: crystal structure of RdgB- inosine triphosphate pyrophosphatase from E. coli
PDB Compounds: (A:) Hypothetical protein yggV

SCOPe Domain Sequences for d1k7ka_:

Sequence, based on SEQRES records: (download)

>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]}
ssgrenlyfqghmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfie
nailkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkd
vpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegkt
aaeltreeksaishrgqalkllldalrng

Sequence, based on observed residues (ATOM records): (download)

>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]}
ssgrenlyfhmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfiena
ilkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkdvp
ddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaa
eltreeksaishrgqalkllldalrng

SCOPe Domain Coordinates for d1k7ka_:

Click to download the PDB-style file with coordinates for d1k7ka_.
(The format of our PDB-style files is described here.)

Timeline for d1k7ka_: