![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
![]() | Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
![]() | Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins) Pfam PF01725 |
![]() | Protein Hypothetical protein YggV [75242] (1 species) annotated as putative ribosomal protein |
![]() | Species Escherichia coli [TaxId:562] [75243] (1 PDB entry) |
![]() | Domain d1k7ka_: 1k7k A: [72104] |
PDB Entry: 1k7k (more details), 1.5 Å
SCOPe Domain Sequences for d1k7ka_:
Sequence, based on SEQRES records: (download)
>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]} ssgrenlyfqghmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfie nailkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkd vpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegkt aaeltreeksaishrgqalkllldalrng
>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]} ssgrenlyfhmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfiena ilkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkdvp ddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaa eltreeksaishrgqalkllldalrng
Timeline for d1k7ka_: