SCOPe 2.04: Domain d1k7ka_: 1k7k A:

Lineage for d1k7ka_ (1k7k A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
   Pfam PF01725

6. Protein Hypothetical protein YggV [75242] (1 species)
   annotated as putative ribosomal protein

7. Species Escherichia coli [TaxId:562] [75243] (1 PDB entry)

8. Domain d1k7ka_: 1k7k A: [72104]

Details for d1k7ka_

PDB Entry: 1k7k, 1.5 Å

PDB Description: crystal structure of RdgB- inosine triphosphate pyrophosphatase from E. coli

PDB Compounds: (A:) Hypothetical protein yggV

SCOPe Domain Sequences for d1k7ka_:

Sequence, based on SEQRES records:

>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]}
ssgrenlyfqghmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfie
nailkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkd
vpddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegkt
aaeltreeksaishrgqalkllldalrng

Sequence, based on observed residues (ATOM records):

>d1k7ka_ c.51.4.1 (A:) Hypothetical protein YggV {Escherichia coli [TaxId: 562]}
ssgrenlyfhmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfiena
ilkarhaakvtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkdvp
ddqrqarfhcvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaa
eltreeksaishrgqalkllldalrng

Timeline for d1k7ka_:

• d1k7ka_ first appeared in SCOP 1.61
  
• d1k7ka_ appears in SCOPe 2.03
  
• d1k7ka_ appears in SCOPe 2.05
  
• d1k7ka_ appears in the current release, SCOPe 2.08, called d1k7ka1