Lineage for d1k7ka1 (1k7k A:0-197)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882122Family c.51.4.1: ITPase (Ham1) [52973] (4 proteins)
    Pfam PF01725
  6. 2882123Protein Hypothetical protein YggV [75242] (1 species)
    annotated as putative ribosomal protein
  7. 2882124Species Escherichia coli [TaxId:562] [75243] (1 PDB entry)
  8. 2882125Domain d1k7ka1: 1k7k A:0-197 [72104]
    Other proteins in same PDB: d1k7ka2

Details for d1k7ka1

PDB Entry: 1k7k (more details), 1.5 Å

PDB Description: crystal structure of RdgB- inosine triphosphate pyrophosphatase from E. coli
PDB Compounds: (A:) Hypothetical protein yggV

SCOPe Domain Sequences for d1k7ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ka1 c.51.4.1 (A:0-197) Hypothetical protein YggV {Escherichia coli [TaxId: 562]}
hmqkvvlatgnvgkvrelasllsdfgldivaqtdlgvdsaeetgltfienailkarhaak
vtalpaiaddsglavdvlggapgiysarysgedatdqknlqklletmkdvpddqrqarfh
cvlvylrhaedptplvchgswpgvitrepagtggfgydpiffvpsegktaaeltreeksa
ishrgqalkllldalrng

SCOPe Domain Coordinates for d1k7ka1:

Click to download the PDB-style file with coordinates for d1k7ka1.
(The format of our PDB-style files is described here.)

Timeline for d1k7ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k7ka2