SCOPe 2.07: Domain d1k7ja_: 1k7j A:

Lineage for d1k7ja_ (1k7j A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.115: YrdC/RibB [55820] (1 superfamily)
   core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other

4. Superfamily d.115.1: YrdC/RibB [55821] (3 families)

5. Family d.115.1.1: YrdC-like [55822] (3 proteins)
   contains two additional strands in the C-terminal extension
   automatically mapped to Pfam PF01300

6. Protein Hypothetical protein YciO [75529] (1 species)

7. Species Escherichia coli [TaxId:562] [75530] (2 PDB entries)

8. Domain d1k7ja_: 1k7j A: [72103]
   structural genomics
   complexed with so4

Details for d1k7ja_

PDB Entry: 1k7j, 1.4 Å

PDB Description: Structural Genomics, protein TF1

PDB Compounds: (A:) Protein yciO

SCOPe Domain Sequences for d1k7ja_:

Sequence; same for both SEQRES and ATOM records:

>d1k7ja_ d.115.1.1 (A:) Hypothetical protein YciO {Escherichia coli [TaxId: 562]}
msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlp
dghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktig
mrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrlekqvdliihggylgqk
pttvidltddtpvvvregvgdvkpfl

Timeline for d1k7ja_:

• d1k7ja_ first appeared in SCOP 1.61
  
• d1k7ja_ appears in SCOPe 2.06
  
• d1k7ja_ appears in the current release, SCOPe 2.08