![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.115: YrdC/RibB [55820] (1 superfamily) core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other |
![]() | Superfamily d.115.1: YrdC/RibB [55821] (3 families) ![]() |
![]() | Family d.115.1.1: YrdC-like [55822] (3 proteins) contains two additional strands in the C-terminal extension automatically mapped to Pfam PF01300 |
![]() | Protein Hypothetical protein YciO [75529] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75530] (2 PDB entries) |
![]() | Domain d1k7ja_: 1k7j A: [72103] structural genomics complexed with so4 |
PDB Entry: 1k7j (more details), 1.4 Å
SCOPe Domain Sequences for d1k7ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k7ja_ d.115.1.1 (A:) Hypothetical protein YciO {Escherichia coli [TaxId: 562]} msqffyihpdnpqqrlinqaveivrkggvivyptdsgyalgckiedknamericrirqlp dghnftlmcrdlselstysfvdnvafrlmknntpgnytfilkgtkevprrllqekrktig mrvpsnpiaqallealgepmlstslmlpgseftesdpeeikdrlekqvdliihggylgqk pttvidltddtpvvvregvgdvkpfl
Timeline for d1k7ja_: