Lineage for d1k7ha_ (1k7h A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1873372Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
    core:3 layers: a/b/a; mixed beta-sheet of 8 strands, order 43516728, strand 7 is antiparallel to the rest
  4. 1873373Superfamily c.76.1: Alkaline phosphatase-like [53649] (6 families) (S)
  5. 1873374Family c.76.1.1: Alkaline phosphatase [53650] (2 proteins)
    common fold is decorated with several large insertions
    automatically mapped to Pfam PF00245
  6. 1873375Protein Alkaline phosphatase [53651] (4 species)
  7. 1873470Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (3 PDB entries)
    Uniprot Q9BHT8 # fragment
  8. 1873471Domain d1k7ha_: 1k7h A: [72101]
    complexed with mae, nag, so4, zn

Details for d1k7ha_

PDB Entry: 1k7h (more details), 1.92 Å

PDB Description: crystal structure of shrimp alkaline phosphatase
PDB Compounds: (A:) alkaline phosphatase

SCOPe Domain Sequences for d1k7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdiantdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsathdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

SCOPe Domain Coordinates for d1k7ha_:

Click to download the PDB-style file with coordinates for d1k7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k7ha_: