Lineage for d1k7ha_ (1k7h A:)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 185039Fold c.76: Alkaline phosphatase-like [53648] (1 superfamily)
  4. 185040Superfamily c.76.1: Alkaline phosphatase-like [53649] (3 families) (S)
  5. 185041Family c.76.1.1: Alkaline phosphatase [53650] (1 protein)
  6. 185042Protein Alkaline phosphatase [53651] (3 species)
  7. 185108Species Northern shrimp (Pandalus borealis) [TaxId:6703] [75300] (1 PDB entry)
  8. 185109Domain d1k7ha_: 1k7h A: [72101]

Details for d1k7ha_

PDB Entry: 1k7h (more details), 1.92 Å

PDB Description: crystal structure of shrimp alkaline phosphatase

SCOP Domain Sequences for d1k7ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis)}
eedkaywnkdaqdaldkqlgiklrekqaknvifflgdgmslstvtaariykggltgkfer
ekisweefdfaalsktyntdkqvtdsaasatayltgvktnqgvigldantvrtncsyqld
eslftysiahwfqeagrstgvvtstrvthatpagtyahvadrdwendsdvvhdredpeic
ddiaeqlvfrepgknfkvimgggrrgffpeealdiedgipgeredgkhlitdwlddkasq
gatasyvwnrddllavdiantdylmglfsythldtvltrdaemdptlpemtkvaiemltk
dengffllveggridhmhhanqirqslaetldmeeavsmalsmtdpeetiilvtadhght
ltitgyadrntdildfagisdlddrrytildygsgpgyhitedgkryepteedlkdinfr
yasaapkhsathdgtdvgiwvngpfahlftgvyeenyiphalayaacvgtgrtfcd

SCOP Domain Coordinates for d1k7ha_:

Click to download the PDB-style file with coordinates for d1k7ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k7ha_: