Lineage for d1k7ea_ (1k7e A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2079053Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2079565Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 protein domains)
  6. 2079595Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2079644Species Salmonella typhimurium [TaxId:90371] [51389] (46 PDB entries)
  8. 2079672Domain d1k7ea_: 1k7e A: [72097]
    Other proteins in same PDB: d1k7eb_
    complexed with iag, na, plp

Details for d1k7ea_

PDB Entry: 1k7e (more details), 2.3 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with n-[1h-indol-3-yl-acetyl]glycine acid
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1k7ea_:

Sequence, based on SEQRES records: (download)

>d1k7ea_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

Sequence, based on observed residues (ATOM records): (download)

>d1k7ea_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivkiieknlas
pkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d1k7ea_:

Click to download the PDB-style file with coordinates for d1k7ea_.
(The format of our PDB-style files is described here.)

Timeline for d1k7ea_: