Lineage for d1k77a_ (1k77 A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1825255Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) (S)
    different families share similar but non-identical metal-binding sites
  5. 1825542Family c.1.15.5: Hypothetical protein YgbM (EC1530) [75093] (1 protein)
    automatically mapped to Pfam PF01261
  6. 1825543Protein Hypothetical protein YgbM (EC1530) [75094] (1 species)
  7. 1825544Species Escherichia coli [TaxId:562] [75095] (1 PDB entry)
  8. 1825545Domain d1k77a_: 1k77 A: [72096]
    Structural genomics
    complexed with fmt, gol, mg

Details for d1k77a_

PDB Entry: 1k77 (more details), 1.63 Å

PDB Description: Crystal Structure of EC1530, a Putative Oxygenase from Escherichia coli
PDB Compounds: (A:) Hypothetical protein ygbM

SCOPe Domain Sequences for d1k77a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k77a_ c.1.15.5 (A:) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]}
mprfaanlsmmftevpfierfaaarkagfdaveflfpynystlqiqkqleqnhltlalfn
tapgdinagewglsalpgreheahadidlaleyalalnceqvhvmagvvpagedaeryra
vfidniryaadrfaphgkrilvealspgvkphylfssqyqalaiveevardnvfiqldtf
haqkvdgnlthlirdyagkyahvqiaglpdrhepddgeinypwlfrlfdevgyqgwigce
ykprglteeglgwfdawrgs

SCOPe Domain Coordinates for d1k77a_:

Click to download the PDB-style file with coordinates for d1k77a_.
(The format of our PDB-style files is described here.)

Timeline for d1k77a_: