| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.15: Xylose isomerase-like [51658] (8 families) ![]() different families share similar but non-identical metal-binding sites |
| Family c.1.15.5: Hypothetical protein YgbM (EC1530) [75093] (1 protein) automatically mapped to Pfam PF01261 |
| Protein Hypothetical protein YgbM (EC1530) [75094] (1 species) |
| Species Escherichia coli [TaxId:562] [75095] (1 PDB entry) |
| Domain d1k77a1: 1k77 A:1-258 [72096] Other proteins in same PDB: d1k77a2 Structural genomics complexed with fmt, gol, mg |
PDB Entry: 1k77 (more details), 1.63 Å
SCOPe Domain Sequences for d1k77a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k77a1 c.1.15.5 (A:1-258) Hypothetical protein YgbM (EC1530) {Escherichia coli [TaxId: 562]}
mprfaanlsmmftevpfierfaaarkagfdaveflfpynystlqiqkqleqnhltlalfn
tapgdinagewglsalpgreheahadidlaleyalalnceqvhvmagvvpagedaeryra
vfidniryaadrfaphgkrilvealspgvkphylfssqyqalaiveevardnvfiqldtf
haqkvdgnlthlirdyagkyahvqiaglpdrhepddgeinypwlfrlfdevgyqgwigce
ykprglteeglgwfdawr
Timeline for d1k77a1: