SCOP 1.73: Domain d1k6ql1: 1k6q L:1-107

Lineage for d1k6ql1 (1k6q L:1-107)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1k6ql1: 1k6q L:1-107 [72094]
   Other proteins in same PDB: d1k6qh1, d1k6qh2, d1k6ql2
   part of anti-human tissue factor Fab D3

Details for d1k6ql1

PDB Entry: 1k6q, 2.4 Å

PDB Description: Crystal structure of antibody Fab fragment D3

PDB Compounds: (L:) immunoglobulin Fab D3, light chain

SCOP Domain Sequences for d1k6ql1:

Sequence; same for both SEQRES and ATOM records:

>d1k6ql1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelk

Timeline for d1k6ql1:

• d1k6ql1 first appeared in SCOP 1.61
  
• d1k6ql1 appears in SCOP 1.71
  
• d1k6ql1 appears in SCOP 1.75
  
• d1k6ql1 appears in the current release, SCOPe 2.08