SCOP 1.63: Domain d1k6ql1: 1k6q L:1-107

Lineage for d1k6ql1 (1k6q L:1-107)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Anti-human tissue factor Fab D3 (mouse), kappa L chain [74809] (1 PDB entry)

8. Domain d1k6ql1: 1k6q L:1-107 [72094]
   Other proteins in same PDB: d1k6qh2, d1k6ql2

Details for d1k6ql1

PDB Entry: 1k6q, 2.4 Å

PDB Description: Crystal structure of antibody Fab fragment D3

SCOP Domain Sequences for d1k6ql1:

Sequence; same for both SEQRES and ATOM records:

>d1k6ql1 b.1.1.1 (L:1-107) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain}
dikmtqspssmsaslgesvtitckasrdiksylswyqqkpwkspktliyyatsladgvps
rfsgsgsgqdysltisslesddtatyyclqhgespftfgsgtklelk

Timeline for d1k6ql1:

• d1k6ql1 first appeared in SCOP 1.61
  
• d1k6ql1 appears in SCOP 1.65
  
• d1k6ql1 appears in the current release, SCOPe 2.08