![]() | Class b: All beta proteins [48724] (111 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (6 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins) |
![]() | Protein Immunoglobulin (variable domains of L and H chains) [48749] (222 species) |
![]() | Species Anti-human tissue factor Fab D3 (mouse), kappa L chain [74809] (1 PDB entry) |
![]() | Domain d1k6qh1: 1k6q H:1-117 [72092] Other proteins in same PDB: d1k6qh2, d1k6ql2 |
PDB Entry: 1k6q (more details), 2.4 Å
SCOP Domain Sequences for d1k6qh1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6qh1 b.1.1.1 (H:1-117) Immunoglobulin (variable domains of L and H chains) {Anti-human tissue factor Fab D3 (mouse), kappa L chain} evqlqqsgaelvrpgalvklsckasgfnikdyymhwvkqrpeqgleligwidpengntiy dpkfqdkasitadtssntaylqlssltsedtavyycardtaayfdywgqgttltvss
Timeline for d1k6qh1: