![]() | Class f: Membrane and cell surface proteins and peptides [56835] (36 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins) L and M are probably related to each other |
![]() | Protein L (light) subunit [81477] (3 species) |
![]() | Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries) |
![]() | Domain d1k6nl_: 1k6n L: [72090] Other proteins in same PDB: d1k6nh1, d1k6nh2, d1k6nm_ complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant |
PDB Entry: 1k6n (more details), 3.1 Å
SCOP Domain Sequences for d1k6nl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k6nl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides} allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff ftnalalalhgalvlsaanpekgkemrtpdhaatffrdlvgysigtlgihrlglllslsa vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging
Timeline for d1k6nl_: