Lineage for d1k6nl_ (1k6n L:)

  1. Root: SCOP 1.63
  2. 267451Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)
  3. 268375Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. 268376Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
  5. 268377Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
    L and M are probably related to each other
  6. 268378Protein L (light) subunit [81477] (3 species)
  7. 268379Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)
  8. 268406Domain d1k6nl_: 1k6n L: [72090]
    Other proteins in same PDB: d1k6nh1, d1k6nh2, d1k6nm_
    complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d1k6nl_

PDB Entry: 1k6n (more details), 3.1 Å

PDB Description: e(l212)a,d(l213)a double mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1k6nl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k6nl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhaatffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

SCOP Domain Coordinates for d1k6nl_:

Click to download the PDB-style file with coordinates for d1k6nl_.
(The format of our PDB-style files is described here.)

Timeline for d1k6nl_: