SCOP 1.63: Domain d1k6nl_: 1k6n L:

Lineage for d1k6nl_ (1k6n L:)

1. Root: SCOP 1.63

2. Class f: Membrane and cell surface proteins and peptides [56835] (34 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81475] (29 PDB entries)

8. Domain d1k6nl_: 1k6n L: [72090]
   Other proteins in same PDB: d1k6nh1, d1k6nh2, d1k6nm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d1k6nl_

PDB Entry: 1k6n, 3.1 Å

PDB Description: e(l212)a,d(l213)a double mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1k6nl_:

Sequence; same for both SEQRES and ATOM records:

>d1k6nl_ f.26.1.1 (L:) L (light) subunit {Rhodobacter sphaeroides}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhaatffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d1k6nl_:

• d1k6nl_ first appeared in SCOP 1.61, called d1k6nl1
  
• d1k6nl_ appears in SCOP 1.65
  
• d1k6nl_ appears in the current release, SCOPe 2.08