SCOP 1.63: Domain d1k6nh1: 1k6n H:36-250

Lineage for d1k6nh1 (1k6n H:36-250)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.41: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50346] (1 family)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (1 protein)

6. Protein Photosynthetic reaction centre [50348] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [50350] (29 PDB entries)

8. Domain d1k6nh1: 1k6n H:36-250 [72088]
   Other proteins in same PDB: d1k6nh2, d1k6nl_, d1k6nm_
   complexed with bcl, bph, cdl, fe, lda, spn, u10; mutant

Details for d1k6nh1

PDB Entry: 1k6n, 3.1 Å

PDB Description: e(l212)a,d(l213)a double mutant structure of photosynthetic reaction center from rhodobacter sphaeroides

SCOP Domain Sequences for d1k6nh1:

Sequence; same for both SEQRES and ATOM records:

>d1k6nh1 b.41.1.1 (H:36-250) Photosynthetic reaction centre {Rhodobacter sphaeroides}
mregyplenedgtpaanqgpfplpkpktfilphgrgtltvpgpesedrpialartavseg
fphaptgdpmkdgvgpaswvarrdlpeldghghnkikpmkaaagfhvsagknpiglpvrg
cdleiagkvvdiwvdipeqmarflevelkdgstrllpmqmvkvqsnrvhvnalssdlfag
iptiksptevtlleedkicgyvagglmyaapkrks

Timeline for d1k6nh1:

• d1k6nh1 first appeared in SCOP 1.61
  
• d1k6nh1 appears in SCOP 1.65
  
• d1k6nh1 appears in the current release, SCOPe 2.08