Lineage for d1k6da_ (1k6d A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150963Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2150964Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2151006Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 protein domains)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2151007Protein Acetate:CoA transferase alpha [75257] (1 species)
  7. 2151008Species Escherichia coli [TaxId:562] [75258] (1 PDB entry)
  8. 2151009Domain d1k6da_: 1k6d A: [72082]
    complexed with mg

Details for d1k6da_

PDB Entry: 1k6d (more details), 1.9 Å

PDB Description: crystal structure of acetate coa-transferase alpha subunit
PDB Compounds: (A:) acetate coa-transferase alpha subunit

SCOPe Domain Sequences for d1k6da_:

Sequence, based on SEQRES records: (download)

>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]}
mktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtg
igplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltp
tgvgtvveegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplial
aaditlvepdelvetgelqpdhivtpgavidhiivsqes

Sequence, based on observed residues (ATOM records): (download)

>d1k6da_ c.124.1.2 (A:) Acetate:CoA transferase alpha {Escherichia coli [TaxId: 562]}
mktklmtlqdatgffrdgmtimvggfmgigtpsrlveallesgvrdltliandtafvdtg
igplivngrvrkviashigtnpetgrrmisgemdvvlvpqgtlieqircggaglggfltp
tgvgtvegkqtltldgktwllerplradlalirahrcdtlgnltyqlsarnfnplialaa
ditlvepdelvetgelqpdhivtpgavidhiivsqes

SCOPe Domain Coordinates for d1k6da_:

Click to download the PDB-style file with coordinates for d1k6da_.
(The format of our PDB-style files is described here.)

Timeline for d1k6da_: