Lineage for d1k5ma_ (1k5m A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431063Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins)
    the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2
    there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus)
  6. 2431184Protein Rhinovirus coat proteins [49670] (5 species)
  7. 2431237Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (36 PDB entries)
  8. 2431267Domain d1k5ma_: 1k5m A: [72078]
    grafted HIV-1 v3 loop in chain B
    complexed with sph

Details for d1k5ma_

PDB Entry: 1k5m (more details), 2.7 Å

PDB Description: crystal structure of a human rhinovirus type 14:human immunodeficiency virus type 1 v3 loop chimeric virus mn-iii-2
PDB Compounds: (A:) coat protein vp1 (p1d)

SCOPe Domain Sequences for d1k5ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k5ma_ b.121.4.1 (A:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]}
eevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetd
vecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfds
eytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrf
svpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhr
akhveawiprapralpytsigrtnypkntepvikkrkgdiksy

SCOPe Domain Coordinates for d1k5ma_:

Click to download the PDB-style file with coordinates for d1k5ma_.
(The format of our PDB-style files is described here.)

Timeline for d1k5ma_: