Class b: All beta proteins [48724] (176 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) |
Family b.121.4.1: Picornaviridae-like VP (VP1, VP2, VP3 and VP4) [88634] (10 proteins) the order of the chains N-VP0-VP3-VP1-C is as in the polyprotein; VP0 is cleaved later upon capsid assembly to VP4 and VP2 there is a different order in the shuffled genome of insect picorna-like proteins (Cricket paralysis virus) |
Protein Rhinovirus coat proteins [49670] (5 species) |
Species Human rhinovirus B 14 (HRV-14) [TaxId:12131] [49671] (30 PDB entries) |
Domain d1k5ma_: 1k5m A: [72078] grafted HIV-1 v3 loop in chain B complexed with sph |
PDB Entry: 1k5m (more details), 2.7 Å
SCOPe Domain Sequences for d1k5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5ma_ b.121.4.1 (A:) Rhinovirus coat proteins {Human rhinovirus B 14 (HRV-14) [TaxId: 12131]} eevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetd vecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfds eytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrf svpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhr akhveawiprapralpytsigrtnypkntepvikkrkgdiksy
Timeline for d1k5ma_: