Lineage for d1k5ma_ (1k5m A:)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.4: Animal virus proteins [49656] (18 proteins) 
Protein Rhinovirus coat protein [49670] (5 species) 
Species Human rhinovirus 14 [TaxId:12131] [49671] (28 PDB entries) 
Domain d1k5ma_: 1k5m A: [72078]
Details for d1k5ma_
PDB Entry: 1k5m (more details), 2.7 Å
PDB Description: crystal structure of a human rhinovirus type 14:human immunodeficiency virus type 1 v3 loop chimeric virus mn-iii-2
SCOP Domain Sequences for d1k5ma_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5ma_ b.10.1.4 (A:) Rhinovirus coat protein {Human rhinovirus 14}
eevivektkqtvasissgpkhtqkvpiltanetgatmpvlpsdsietrttymhfngsetd
vecflgraacvhvteiqnkdatgidnhreaklfndwkinlsslvqlrkklelftyvrfds
eytilatasqpdsanyssnlvvqamyvppgapnpkewddytwqsasnpsvffkvgdtsrf
svpyvglasayncfydgyshddaetqygitvlnhmgsmafrivnehdehktlvkirvyhr
akhveawiprapralpytsigrtnypkntepvikkrkgdiksy
SCOP Domain Coordinates for d1k5ma_:
Click to download the PDB-style file with coordinates for d1k5ma_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k5ma_:
- d1k5ma_ is new in SCOP 1.61
- d1k5ma_ appears in SCOP 1.63
- d1k5ma_ appears in the current release, SCOPe 2.08
View in 3D
