Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.5: RNase A-like [54075] (1 superfamily) contains long curved beta-sheet and 3 helices |
Superfamily d.5.1: RNase A-like [54076] (2 families) can be classified as disulfide-rich |
Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins) |
Protein Angiogenin [54094] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [54095] (30 PDB entries) |
Domain d1k5ba_: 1k5b A: [72075] complexed with cit |
PDB Entry: 1k5b (more details), 1.8 Å
SCOPe Domain Sequences for d1k5ba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k5ba_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]} ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqsif
Timeline for d1k5ba_: