Lineage for d1k59a_ (1k59 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715752Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 715753Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulfide-rich
  5. 715754Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 715773Protein Angiogenin [54094] (2 species)
  7. 715777Species Human (Homo sapiens) [TaxId:9606] [54095] (19 PDB entries)
  8. 715779Domain d1k59a_: 1k59 A: [72073]
    complexed with cit, pca; mutant

Details for d1k59a_

PDB Entry: 1k59 (more details), 1.8 Å

PDB Description: crystal structure of human angiogenin variant q117g
PDB Compounds: (A:) angiogenin

SCOP Domain Sequences for d1k59a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k59a_ d.5.1.1 (A:) Angiogenin {Human (Homo sapiens) [TaxId: 9606]}
ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicenk
ngnphrenlriskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldgsif
rrp

SCOP Domain Coordinates for d1k59a_:

Click to download the PDB-style file with coordinates for d1k59a_.
(The format of our PDB-style files is described here.)

Timeline for d1k59a_: