Lineage for d1k4zb_ (1k4z B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079406Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 2079638Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) (S)
    superhelix turns are made of two strands each
    automatically mapped to Pfam PF08603
  5. 2079639Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (1 protein)
    this is a repeat family; one repeat unit is 1k4z A:1424-1443 found in domain
  6. 2079640Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species)
  7. 2079641Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69343] (2 PDB entries)
  8. 2079643Domain d1k4zb_: 1k4z B: [72071]

Details for d1k4zb_

PDB Entry: 1k4z (more details), 2.3 Å

PDB Description: c-terminal domain of cyclase associated protein
PDB Compounds: (B:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1k4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4zb_ b.80.5.1 (B:) C-terminal domain of adenylylcyclase associated protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqikgkvnaislsetes
csvvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytscstai
nvnlpigedddyvefpipeqmkhsfadgkfksavfeh

SCOPe Domain Coordinates for d1k4zb_:

Click to download the PDB-style file with coordinates for d1k4zb_.
(The format of our PDB-style files is described here.)

Timeline for d1k4zb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k4za_