Lineage for d1k4za_ (1k4z A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1806195Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies)
    superhelix turns are made of parallel beta-strands and (short) turns
  4. 1806427Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) (S)
    superhelix turns are made of two strands each
    automatically mapped to Pfam PF08603
  5. 1806428Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (1 protein)
    this is a repeat family; one repeat unit is 1k4z A:1424-1443 found in domain
  6. 1806429Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species)
  7. 1806430Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69343] (2 PDB entries)
  8. 1806431Domain d1k4za_: 1k4z A: [72070]

Details for d1k4za_

PDB Entry: 1k4z (more details), 2.3 Å

PDB Description: c-terminal domain of cyclase associated protein
PDB Compounds: (A:) Adenylyl cyclase-associated protein

SCOPe Domain Sequences for d1k4za_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4za_ b.80.5.1 (A:) C-terminal domain of adenylylcyclase associated protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mpprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqikgkvnaislsetes
csvvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytscstai
nvnlpigedddyvefpipeqmkhsfadgkfksavfeh

SCOPe Domain Coordinates for d1k4za_:

Click to download the PDB-style file with coordinates for d1k4za_.
(The format of our PDB-style files is described here.)

Timeline for d1k4za_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1k4zb_