Class b: All beta proteins [48724] (176 folds) |
Fold b.80: Single-stranded right-handed beta-helix [51125] (8 superfamilies) superhelix turns are made of parallel beta-strands and (short) turns |
Superfamily b.80.5: C-terminal domain of adenylylcyclase associated protein [69340] (2 families) superhelix turns are made of two strands each automatically mapped to Pfam PF08603 |
Family b.80.5.1: C-terminal domain of adenylylcyclase associated protein [69341] (1 protein) this is a repeat family; one repeat unit is 1k4z A:1424-1443 found in domain |
Protein C-terminal domain of adenylylcyclase associated protein [69342] (2 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [69343] (2 PDB entries) |
Domain d1k4za_: 1k4z A: [72070] |
PDB Entry: 1k4z (more details), 2.3 Å
SCOPe Domain Sequences for d1k4za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4za_ b.80.5.1 (A:) C-terminal domain of adenylylcyclase associated protein {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} mpprkelvgnkwfienyeneteslvidankdesifigkcsqvlvqikgkvnaislsetes csvvldssisgmdviksnkfgiqvnhslpqisidksdggniylskeslnteiytscstai nvnlpigedddyvefpipeqmkhsfadgkfksavfeh
Timeline for d1k4za_: