Lineage for d1k4ya_ (1k4y A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2134062Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2134063Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2134064Family c.69.1.1: Acetylcholinesterase-like [53475] (6 protein domains)
    automatically mapped to Pfam PF00135
  6. 2134248Protein Mammalian carboxylesterase (liver carboxylesterase I) [75282] (2 species)
  7. 2134293Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [75283] (1 PDB entry)
  8. 2134294Domain d1k4ya_: 1k4y A: [72069]
    complexed with 4pn

Details for d1k4ya_

PDB Entry: 1k4y (more details), 2.5 Å

PDB Description: Crystal Structure of Rabbit Liver Carboxylesterase in Complex with 4-piperidino-piperidine
PDB Compounds: (A:) liver carboxylesterase

SCOPe Domain Sequences for d1k4ya_:

Sequence, based on SEQRES records: (download)

>d1k4ya_ c.69.1.1 (A:) Mammalian carboxylesterase (liver carboxylesterase I) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
dgvllpkapaeilaekkynmlpymvginqqefgwiipmqmlgyplsegkldqktatellw
ksypivnvskeltpvatekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagap
tymyeyryrpsfssdmrpktvigdhgdeifsvlgapflkegateeeiklskmvmkywanf
arngnpngeglpqwpaydykegylqigattqaaqklkdkevafwtelwakeaar

Sequence, based on observed residues (ATOM records): (download)

>d1k4ya_ c.69.1.1 (A:) Mammalian carboxylesterase (liver carboxylesterase I) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ppvvdtvhgkvlgkfvslegfaqpvavflgvpfakpplgslrfappqpaeswshvkntts
yppmcsqdavsghmlselftnrkeniplkfsedclylniytpadltkrgrlpvmvwihgg
glmvggastydglalsahenvvvvtiqyrlgiwgffstgdehsrgnwghldqvaalrwvq
dnianfggdpgsvtifgesaggqsvsilllspltknlfhraisesgvallsslfrkntks
laekiaieagcktttsavmvhclrqkteeelmevtlkmkfmaldlvgdpkentaflttvi
dgvllpkapaeilaekkynmlpymvginqqefkldqktatellwksypivnvskeltpva
tekylggtddpvkkkdlfldmladllfgvpsvnvarhhrdagaptymyeyrhgdeifsvl
gapflkegateeeiklskmvmkywanfarngnpngeglpqwpaydykegylqigattqaa
qklkdkevafwtelwakeaar

SCOPe Domain Coordinates for d1k4ya_:

Click to download the PDB-style file with coordinates for d1k4ya_.
(The format of our PDB-style files is described here.)

Timeline for d1k4ya_: