Lineage for d1k4us_ (1k4u S:)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1120542Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 1120633Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 1120634Family b.34.2.1: SH3-domain [50045] (40 proteins)
  6. 1120890Protein p67phox [74922] (1 species)
  7. 1120891Species Human (Homo sapiens) [TaxId:9606] [74923] (1 PDB entry)
  8. 1120892Domain d1k4us_: 1k4u S: [72065]
    C-terminal SH3 domain complexed with the C-terminal tail of p47phox (chain P)

Details for d1k4us_

PDB Entry: 1k4u (more details)

PDB Description: solution structure of the c-terminal sh3 domain of p67phox complexed with the c-terminal tail region of p47phox
PDB Compounds: (S:) phagocyte nadph oxidase subunit p67phox

SCOPe Domain Sequences for d1k4us_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]}
qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds
at

SCOPe Domain Coordinates for d1k4us_:

Click to download the PDB-style file with coordinates for d1k4us_.
(The format of our PDB-style files is described here.)

Timeline for d1k4us_: