Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (1 family) |
Family b.34.2.1: SH3-domain [50045] (39 proteins) |
Protein p67phox [74922] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [74923] (1 PDB entry) |
Domain d1k4us_: 1k4u S: [72065] C-terminal SH3 domain complexed with the C-terminal tail of p47phox (chain P) mutant |
PDB Entry: 1k4u (more details)
SCOP Domain Sequences for d1k4us_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds at
Timeline for d1k4us_: