Lineage for d1k4us_ (1k4u S:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165582Protein p67phox [74922] (1 species)
  7. 165583Species Human (Homo sapiens) [TaxId:9606] [74923] (1 PDB entry)
  8. 165584Domain d1k4us_: 1k4u S: [72065]

Details for d1k4us_

PDB Entry: 1k4u (more details)

PDB Description: Solution structure of the C-terminal SH3 domain of p67phox complexed with the C-terminal tail region of p47phox

SCOP Domain Sequences for d1k4us_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens)}
qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds
at

SCOP Domain Coordinates for d1k4us_:

Click to download the PDB-style file with coordinates for d1k4us_.
(The format of our PDB-style files is described here.)

Timeline for d1k4us_: