SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1k4us_ (1k4u S:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046079Protein p67phox [74922] (1 species)
  7. 2046080Species Human (Homo sapiens) [TaxId:9606] [74923] (3 PDB entries)
  8. 2046083Domain d1k4us_: 1k4u S: [72065]
    C-terminal SH3 domain complexed with the C-terminal tail of p47phox (chain P)

Details for d1k4us_

PDB Entry: 1k4u (more details)

PDB Description: Solution structure of the C-terminal SH3 domain of p67phox complexed with the C-terminal tail region of p47phox
PDB Compounds: (S:) phagocyte nadph oxidase subunit p67phox

SCOPe Domain Sequences for d1k4us_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]}
qlkkgsqvealfsyeatqpedlefqegdiilvlskvneewlegeskgkvgifpkvfveds
at

SCOPe Domain Coordinates for d1k4us_:

Click to download the PDB-style file with coordinates for d1k4us_.
(The format of our PDB-style files is described here.)

Timeline for d1k4us_: