Lineage for d1k4pa_ (1k4p A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2578543Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 2578544Superfamily d.115.1: YrdC/RibB [55821] (3 families) (S)
  5. 2578559Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (2 proteins)
    contains one additional helix in the C-terminal extension
    automatically mapped to Pfam PF00926
  6. 2578560Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (4 species)
  7. 2578567Species Fungus (Magnaporthe grisea) [TaxId:148305] [75533] (5 PDB entries)
  8. 2578569Domain d1k4pa_: 1k4p A: [72061]
    complexed with so4, zn

Details for d1k4pa_

PDB Entry: 1k4p (more details), 1 Å

PDB Description: Crystal Structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase in complex with zinc ions
PDB Compounds: (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase

SCOPe Domain Sequences for d1k4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4pa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Fungus (Magnaporthe grisea) [TaxId: 148305]}
fdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicapltp
erttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrmlaapdaqpshf
rrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraap
gmlrgdecvafarrwglkvctiedmiahvektegkl

SCOPe Domain Coordinates for d1k4pa_:

Click to download the PDB-style file with coordinates for d1k4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k4pa_: