Lineage for d1k4pa_ (1k4p A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 195933Fold d.115: YrdC/RibB [55820] (1 superfamily)
  4. 195934Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 195946Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
  6. 195947Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (2 species)
  7. 195954Species Magnaporthe grisea [TaxId:148305] [75533] (5 PDB entries)
  8. 195956Domain d1k4pa_: 1k4p A: [72061]

Details for d1k4pa_

PDB Entry: 1k4p (more details), 1 Å

PDB Description: Crystal Structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase in complex with zinc ions

SCOP Domain Sequences for d1k4pa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4pa_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea}
fdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicapltp
erttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrmlaapdaqpshf
rrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraap
gmlrgdecvafarrwglkvctiedmiahvektegkl

SCOP Domain Coordinates for d1k4pa_:

Click to download the PDB-style file with coordinates for d1k4pa_.
(The format of our PDB-style files is described here.)

Timeline for d1k4pa_: