![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily) beta-alpha-beta(3); 2 layers: alpha/beta |
![]() | Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) ![]() |
![]() | Family d.32.1.5: Hypothetical protein YecM (EC4020) [75396] (1 protein) Similar subunit fold is to methylmalonyl-CoA epimerase automatically mapped to Pfam PF06185 |
![]() | Protein Hypothetical protein YecM (EC4020) [75397] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [75398] (1 PDB entry) |
![]() | Domain d1k4na1: 1k4n A:5-190 [72059] Other proteins in same PDB: d1k4na2 structural genomics |
PDB Entry: 1k4n (more details), 1.6 Å
SCOPe Domain Sequences for d1k4na1:
Sequence, based on SEQRES records: (download)
>d1k4na1 d.32.1.5 (A:5-190) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} manwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerwrrgf eqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpg dpetlnaralallsdeglslpgisvktsspkgeherlpnptlavtdgkttikfhpwsiee ivaseq
>d1k4na1 d.32.1.5 (A:5-190) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]} manwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerwrrgf eqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpg dpetlnaralallsdeglslpgisvktsrlpnptlavtdgkttikfhpwsieeivaseq
Timeline for d1k4na1: