Lineage for d1k4na_ (1k4n A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 190970Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
  4. 190971Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (5 families) (S)
  5. 191082Family d.32.1.5: Hypothetical protein YecM (EC4020) [75396] (1 protein)
  6. 191083Protein Hypothetical protein YecM (EC4020) [75397] (1 species)
  7. 191084Species Escherichia coli [TaxId:562] [75398] (1 PDB entry)
  8. 191085Domain d1k4na_: 1k4n A: [72059]

Details for d1k4na_

PDB Entry: 1k4n (more details), 1.6 Å

PDB Description: Structural Genomics, Protein EC4020

SCOP Domain Sequences for d1k4na_:

Sequence, based on SEQRES records: (download)

>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli}
ghmimanwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerw
rrgfeqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehiei
vlpgdpetlnaralallsdeglslpgisvktsspkgeherlpnptlavtdgkttikfhpw
sieeivaseq

Sequence, based on observed residues (ATOM records): (download)

>d1k4na_ d.32.1.5 (A:) Hypothetical protein YecM (EC4020) {Escherichia coli}
ghmimanwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerw
rrgfeqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehiei
vlpgdpetlnaralallsdeglslpgisvktsrlpnptlavtdgkttikfhpwsieeiva
seq

SCOP Domain Coordinates for d1k4na_:

Click to download the PDB-style file with coordinates for d1k4na_.
(The format of our PDB-style files is described here.)

Timeline for d1k4na_: