Lineage for d1k4na1 (1k4n A:5-190)

  1. Root: SCOPe 2.06
  2. 2152203Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2166686Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2166687Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2167099Family d.32.1.5: Hypothetical protein YecM (EC4020) [75396] (1 protein)
    Similar subunit fold is to methylmalonyl-CoA epimerase
    automatically mapped to Pfam PF06185
  6. 2167100Protein Hypothetical protein YecM (EC4020) [75397] (1 species)
  7. 2167101Species Escherichia coli [TaxId:562] [75398] (1 PDB entry)
  8. 2167102Domain d1k4na1: 1k4n A:5-190 [72059]
    Other proteins in same PDB: d1k4na2
    structural genomics

Details for d1k4na1

PDB Entry: 1k4n (more details), 1.6 Å

PDB Description: Structural Genomics, Protein EC4020
PDB Compounds: (A:) Protein EC4020

SCOPe Domain Sequences for d1k4na1:

Sequence, based on SEQRES records: (download)

>d1k4na1 d.32.1.5 (A:5-190) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]}
manwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerwrrgf
eqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpg
dpetlnaralallsdeglslpgisvktsspkgeherlpnptlavtdgkttikfhpwsiee
ivaseq

Sequence, based on observed residues (ATOM records): (download)

>d1k4na1 d.32.1.5 (A:5-190) Hypothetical protein YecM (EC4020) {Escherichia coli [TaxId: 562]}
manwqsidelqdiasdlprfihaldelsrrlglnitpltadhislrchqnataerwrrgf
eqcgellsenmingrpiclfklhepvqvahwqfsivelpwpgekryphegwehieivlpg
dpetlnaralallsdeglslpgisvktsrlpnptlavtdgkttikfhpwsieeivaseq

SCOPe Domain Coordinates for d1k4na1:

Click to download the PDB-style file with coordinates for d1k4na1.
(The format of our PDB-style files is described here.)

Timeline for d1k4na1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k4na2