Lineage for d1k4ja1 (1k4j A:1-210)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2209196Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2209197Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2209655Family d.108.1.3: Autoinducer synthetase [75508] (2 proteins)
    Pfam PF00765
  6. 2209656Protein Acyl-homoserinelactone synthase EsaI [75509] (1 species)
  7. 2209657Species Pantoea stewartii subsp. stewartii [TaxId:66271] [75510] (2 PDB entries)
  8. 2209659Domain d1k4ja1: 1k4j A:1-210 [72057]
    Other proteins in same PDB: d1k4ja2
    complexed with reo

Details for d1k4ja1

PDB Entry: 1k4j (more details), 2.5 Å

PDB Description: Crystal Structure of the Acyl-homoserinelactone Synthase EsaI Complexed with Rhenate
PDB Compounds: (A:) acyl-homoserinelactone synthase EsaI

SCOPe Domain Sequences for d1k4ja1:

Sequence, based on SEQRES records: (download)

>d1k4ja1 d.108.1.3 (A:1-210) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}
mlelfdvsyeelqttrseelyklrkktfsdrlgwevicsqgmesdefdgpgtryilgice
gqlvcsvrftsldrpnmithtfqhcfsdvtlpaygtessrffvdkararallgehypisq
vlflamvnwaqnnaygniytivsramlkiltrsgwqikvikeafltekeriylltlpagq
ddkqqlggdvvsrtgcppvavttwpltlpv

Sequence, based on observed residues (ATOM records): (download)

>d1k4ja1 d.108.1.3 (A:1-210) Acyl-homoserinelactone synthase EsaI {Pantoea stewartii subsp. stewartii [TaxId: 66271]}
mlelfdvsyeelrlgwevicsqgmesdefdgpgtryilgicegqlvcsvrftsldrpnmi
thtfqhcfsdvtlpaygtessrffvdkararallgehypisqvlflamvnwaqnnaygni
ytivsramlkiltrsgwqikvikeafltekeriylltlpagqddkqqlggdvvsrtgcpp
vavttwpltlpv

SCOPe Domain Coordinates for d1k4ja1:

Click to download the PDB-style file with coordinates for d1k4ja1.
(The format of our PDB-style files is described here.)

Timeline for d1k4ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k4ja2