Lineage for d1k4ha_ (1k4h A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2089551Superfamily c.1.20: tRNA-guanine transglycosylase [51713] (1 family) (S)
  5. 2089552Family c.1.20.1: tRNA-guanine transglycosylase [51714] (2 protein domains)
  6. 2089563Protein Queosine tRNA-guanine transglycosylase [51715] (3 species)
    contains zinc-binding subdomain
  7. 2089589Species Zymomonas mobilis [TaxId:542] [51716] (113 PDB entries)
    Uniprot P28720
  8. 2089646Domain d1k4ha_: 1k4h A: [72055]
    protein/RNA complex; complexed with apq, zn

Details for d1k4ha_

PDB Entry: 1k4h (more details), 1.8 Å

PDB Description: crystal structure of trna-guanine transglycosylase (tgt) complexed with 2,6-diamino-8-propylsulfanylmethyl-3h-quinazoline-4-one
PDB Compounds: (A:) tRNA-guanine-transglycosylase

SCOPe Domain Sequences for d1k4ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k4ha_ c.1.20.1 (A:) Queosine tRNA-guanine transglycosylase {Zymomonas mobilis [TaxId: 542]}
rprfsfsiaaregkartgtiemkrgvirtpafmpvgtaatvkalkpetvratgadiilgn
tyhlmlrpgaeriaklgglhsfmgwdrpiltdsggyqvmslssltkqseegvtfkshldg
srhmlspersieiqhllgsdivmafdectpypatpsraassmersmrwakrsrdafdsrk
eqaenaalfgiqqgsvfenlrqqsadalaeigfdgyavgglavgegqdemfrvldfsvpm
lpddkphylmgvgkpddivgavergidmfdcvlptrsgrngqaftwdgpinirnarfsed
lkpldsechcavcqkwsrayihhlirageilgamlmtehniafyqqlmqkirdsisegrf
sqfaqdfraryf

SCOPe Domain Coordinates for d1k4ha_:

Click to download the PDB-style file with coordinates for d1k4ha_.
(The format of our PDB-style files is described here.)

Timeline for d1k4ha_: