Lineage for d1k49a_ (1k49 A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 417481Fold d.115: YrdC/RibB [55820] (1 superfamily)
    core: alpha-beta(2)-alpha-beta-alpha(2)-beta(2)-alpha-beta-alpha-beta; 3 layers; mixed twisted sheet of 7 strands; order 7126354; strands 7 and 1 are parallel to each other
  4. 417482Superfamily d.115.1: YrdC/RibB [55821] (2 families) (S)
  5. 417495Family d.115.1.2: 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64372] (1 protein)
    contains one additional helix in the C-terminal extension
  6. 417496Protein 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB [64373] (3 species)
  7. 417509Species Magnaporthe grisea [TaxId:148305] [75533] (5 PDB entries)
  8. 417513Domain d1k49a_: 1k49 A: [72053]
    complexed with sul

Details for d1k49a_

PDB Entry: 1k49 (more details), 1.5 Å

PDB Description: crystal structure of 3,4-dihydroxy-2-butanone 4-phosphate synthase (cation free form)

SCOP Domain Sequences for d1k49a_:

Sequence, based on SEQRES records: (download)

>d1k49a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea}
nfdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicaplt
perttaldlpqmvthnadprgtaytvsvdaehpstttgisahdralacrmlaapdaqpsh
frrpghvfplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraa
pgmlrgdecvafarrwglkvctiedmiahvekteg

Sequence, based on observed residues (ATOM records): (download)

>d1k49a_ d.115.1.2 (A:) 3,4-dihydroxy-2-butanone 4-phosphate synthase, DHBP synthase, RibB {Magnaporthe grisea}
nfdaipdviqafkngefvvvlddpsreneadliiaaesvtteqmafmvrhssglicaplt
perttaldlpqmvgtaytvsvdaehpstttgisahdralacrmlaapdaqpshfrrpghv
fplravaggvrarrghteagvelcrlagkrpvaviseivddgqevegravraapgmlrgd
ecvafarrwglkvctiedmiahvekteg

SCOP Domain Coordinates for d1k49a_:

Click to download the PDB-style file with coordinates for d1k49a_.
(The format of our PDB-style files is described here.)

Timeline for d1k49a_: