Lineage for d1k47e1 (1k47 E:1-194)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 189110Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
  4. 189111Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (5 families) (S)
  5. 189181Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (4 proteins)
  6. 189206Protein Phosphomevalonate kinase (PMK) [75356] (1 species)
  7. 189207Species Streptococcus pneumoniae r6 [TaxId:171101] [75357] (1 PDB entry)
  8. 189212Domain d1k47e1: 1k47 E:1-194 [72048]
    Other proteins in same PDB: d1k47a2, d1k47b2, d1k47c2, d1k47d2, d1k47e2, d1k47f2

Details for d1k47e1

PDB Entry: 1k47 (more details), 2.42 Å

PDB Description: Crystal Structure of the Streptococcus pneumoniae Phosphomevalonate Kinase (PMK)
PDB Compounds: (E:)

SCOP Domain Sequences for d1k47e1:

Sequence, based on SEQRES records: (download)

>d1k47e1 d.14.1.5 (E:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6}
miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlrpn
pdysliqetialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkalla
lynlsvdqnllfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenla
tvlerdwgfsisqv

Sequence, based on observed residues (ATOM records): (download)

>d1k47e1 d.14.1.5 (E:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6}
miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmnpdysliqet
ialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkallalynlsvdqn
llfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenlatvlerdwgf
sisqv

SCOP Domain Coordinates for d1k47e1:

Click to download the PDB-style file with coordinates for d1k47e1.
(The format of our PDB-style files is described here.)

Timeline for d1k47e1: