![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (2 proteins) |
![]() | Protein Phosphomevalonate kinase (PMK) [75455] (1 species) |
![]() | Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (2 PDB entries) |
![]() | Domain d1k47c2: 1k47 C:195-329 [72045] Other proteins in same PDB: d1k47a1, d1k47a3, d1k47b1, d1k47b3, d1k47c1, d1k47c3, d1k47d1, d1k47d3, d1k47e1, d1k47e3, d1k47f1, d1k47f3 |
PDB Entry: 1k47 (more details), 2.42 Å
SCOPe Domain Sequences for d1k47c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k47c2 d.58.26.4 (C:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]} kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn rwadlgiellyqeri
Timeline for d1k47c2: