Lineage for d1k47c1 (1k47 C:1-194)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2500239Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 2500240Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families) (S)
  5. 2500678Family d.14.1.5: GHMP Kinase, N-terminal domain [54232] (7 protein domains)
  6. 2500736Protein Phosphomevalonate kinase (PMK) [75356] (1 species)
  7. 2500737Species Streptococcus pneumoniae r6 [TaxId:171101] [75357] (2 PDB entries)
  8. 2500741Domain d1k47c1: 1k47 C:1-194 [72044]
    Other proteins in same PDB: d1k47a2, d1k47a3, d1k47b2, d1k47b3, d1k47c2, d1k47c3, d1k47d2, d1k47d3, d1k47e2, d1k47e3, d1k47f2, d1k47f3

Details for d1k47c1

PDB Entry: 1k47 (more details), 2.42 Å

PDB Description: Crystal Structure of the Streptococcus pneumoniae Phosphomevalonate Kinase (PMK)
PDB Compounds: (C:) phosphomevalonate kinase

SCOPe Domain Sequences for d1k47c1:

Sequence, based on SEQRES records: (download)

>d1k47c1 d.14.1.5 (C:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]}
miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmfdfavdlrpn
pdysliqetialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkalla
lynlsvdqnllfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenla
tvlerdwgfsisqv

Sequence, based on observed residues (ATOM records): (download)

>d1k47c1 d.14.1.5 (C:1-194) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]}
miavktcgklywageyailepgqlalikdipiymraeiafsdsyriysdmnpdysliqet
ialmgdflavrgqnlrpfslaiygkmeregkkfglgssgsvvvlvvkallalynlsvdqn
llfkltsavllkrgdngsmgdlaciaaedlvlyqsfdrqkvaawleeenlatvlerdwgf
sisqv

SCOPe Domain Coordinates for d1k47c1:

Click to download the PDB-style file with coordinates for d1k47c1.
(The format of our PDB-style files is described here.)

Timeline for d1k47c1: