Lineage for d1k47b2 (1k47 B:195-329)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2192663Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2197530Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (8 families) (S)
    common fold is elaborated with additional secondary structures
  5. 2197565Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (2 proteins)
  6. 2197566Protein Phosphomevalonate kinase (PMK) [75455] (1 species)
  7. 2197567Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (2 PDB entries)
  8. 2197570Domain d1k47b2: 1k47 B:195-329 [72043]
    Other proteins in same PDB: d1k47a1, d1k47a3, d1k47b1, d1k47b3, d1k47c1, d1k47c3, d1k47d1, d1k47d3, d1k47e1, d1k47e3, d1k47f1, d1k47f3

Details for d1k47b2

PDB Entry: 1k47 (more details), 2.42 Å

PDB Description: Crystal Structure of the Streptococcus pneumoniae Phosphomevalonate Kinase (PMK)
PDB Compounds: (B:) phosphomevalonate kinase

SCOPe Domain Sequences for d1k47b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k47b2 d.58.26.4 (B:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6 [TaxId: 171101]}
kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq
vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn
rwadlgiellyqeri

SCOPe Domain Coordinates for d1k47b2:

Click to download the PDB-style file with coordinates for d1k47b2.
(The format of our PDB-style files is described here.)

Timeline for d1k47b2: