SCOP 1.71: Domain d1k47a2: 1k47 A:195-329

Lineage for d1k47a2 (1k47 A:195-329)

Root: SCOP 1.71
Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
common fold is elaborated with additional secondary structures
Family d.58.26.4: Phosphomevalonate kinase (PMK) [75454] (1 protein)
Protein Phosphomevalonate kinase (PMK) [75455] (1 species)
Species Streptococcus pneumoniae r6 [TaxId:171101] [75456] (1 PDB entry)
Domain d1k47a2: 1k47 A:195-329 [72041]
Other proteins in same PDB: d1k47a1, d1k47b1, d1k47c1, d1k47d1, d1k47e1, d1k47f1

Details for d1k47a2

PDB Entry: 1k47 (more details), 2.42 Å

PDB Description: crystal structure of the streptococcus pneumoniae phosphomevalonate kinase (pmk)

SCOP Domain Sequences for d1k47a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k47a2 d.58.26.4 (A:195-329) Phosphomevalonate kinase (PMK) {Streptococcus pneumoniae r6}
kptlecdflvgwtkevavsshmvqqikqninqnfltssketvvslvealeqgksekiieq
vevasklleglstdiytpllrqlkeasqdlqavakssgagggdcgialsfdaqstktlkn
rwadlgiellyqeri

SCOP Domain Coordinates for d1k47a2:

Click to download the PDB-style file with coordinates for d1k47a2.
(The format of our PDB-style files is described here.)

Timeline for d1k47a2: