Lineage for d1k45a1 (1k45 A:1-164)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2383785Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2383786Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2384298Family b.18.1.14: CBM4/9 [74893] (4 proteins)
  6. 2384299Protein Carbohydrate binding module from a thermostable xylanase [74894] (1 species)
  7. 2384300Species Rhodothermus marinus [TaxId:29549] [74895] (2 PDB entries)
  8. 2384301Domain d1k45a1: 1k45 A:1-164 [72039]
    Other proteins in same PDB: d1k45a2
    second CBM4

Details for d1k45a1

PDB Entry: 1k45 (more details)

PDB Description: the solution structure of the cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase.
PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1k45a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k45a1 b.18.1.14 (A:1-164) Carbohydrate binding module from a thermostable xylanase {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglai

SCOPe Domain Coordinates for d1k45a1:

Click to download the PDB-style file with coordinates for d1k45a1.
(The format of our PDB-style files is described here.)

Timeline for d1k45a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1k45a2