Lineage for d1k45a_ (1k45 A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 662025Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 662026Superfamily b.18.1: Galactose-binding domain-like [49785] (30 families) (S)
  5. 662352Family b.18.1.14: CBM4/9 [74893] (3 proteins)
  6. 662353Protein Carbohydrate binding module from a thermostable xylanase [74894] (1 species)
  7. 662354Species Rhodothermus marinus [TaxId:29549] [74895] (2 PDB entries)
  8. 662356Domain d1k45a_: 1k45 A: [72039]
    second CBM4

Details for d1k45a_

PDB Entry: 1k45 (more details)

PDB Description: the solution structure of the cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase.
PDB Compounds: (A:) xylanase

SCOP Domain Sequences for d1k45a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k45a_ b.18.1.14 (A:) Carbohydrate binding module from a thermostable xylanase {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaiasqp

SCOP Domain Coordinates for d1k45a_:

Click to download the PDB-style file with coordinates for d1k45a_.
(The format of our PDB-style files is described here.)

Timeline for d1k45a_: