SCOPe 2.08: Domain d1k45a1: 1k45 A:1-164

Lineage for d1k45a1 (1k45 A:1-164)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
   sandwich; 9 strands in 2 sheets; jelly-roll

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families)

5. Family b.18.1.14: CBM4/9 [74893] (4 proteins)

6. Protein Carbohydrate binding module from a thermostable xylanase [74894] (1 species)

7. Species Rhodothermus marinus [TaxId:29549] [74895] (2 PDB entries)

8. Domain d1k45a1: 1k45 A:1-164 [72039]
   Other proteins in same PDB: d1k45a2
   second CBM4

Details for d1k45a1

PDB Entry: 1k45

PDB Description: the solution structure of the cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase.

PDB Compounds: (A:) xylanase

SCOPe Domain Sequences for d1k45a1:

Sequence; same for both SEQRES and ATOM records:

>d1k45a1 b.18.1.14 (A:1-164) Carbohydrate binding module from a thermostable xylanase {Rhodothermus marinus [TaxId: 29549]}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglai

Timeline for d1k45a1:

• d1k45a1 first appeared in SCOP 1.61, called d1k45a_
  
• d1k45a1 appears in SCOPe 2.07