Lineage for d1k44f_ (1k44 F:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 191935Fold d.58: Ferredoxin-like [54861] (40 superfamilies)
  4. 192178Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 192179Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 192180Protein Nucleoside diphosphate kinases [54921] (8 species)
  7. 192262Species Mycobacterium tuberculosis [TaxId:1773] [75438] (1 PDB entry)
  8. 192268Domain d1k44f_: 1k44 F: [72038]

Details for d1k44f_

PDB Entry: 1k44 (more details), 2.6 Å

PDB Description: Mycobacterium tuberculosis Nucleoside Diphosphate Kinase

SCOP Domain Sequences for d1k44f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k44f_ d.58.6.1 (F:) Nucleoside diphosphate kinases {Mycobacterium tuberculosis}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga

SCOP Domain Coordinates for d1k44f_:

Click to download the PDB-style file with coordinates for d1k44f_.
(The format of our PDB-style files is described here.)

Timeline for d1k44f_: