Lineage for d1k44b_ (1k44 B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.58: Ferredoxin-like [54861] (40 superfamilies) 
Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) 
Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein) Protein Nucleoside diphosphate kinases [54921] (8 species) 
Species Mycobacterium tuberculosis [TaxId:1773] [75438] (1 PDB entry) 
Domain d1k44b_: 1k44 B: [72034]
Details for d1k44b_
PDB Entry: 1k44 (more details), 2.6 Å
PDB Description: Mycobacterium tuberculosis Nucleoside Diphosphate Kinase
SCOP Domain Sequences for d1k44b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1k44b_ d.58.6.1 (B:) Nucleoside diphosphate kinases {Mycobacterium tuberculosis}
tertlvlikpdgierqligeiisrierkgltiaalqlrtvsaelasqhyaehegkpffgs
llefitsgpvvaaivegtraiaavrqlaggtdpvqaaapgtirgdfaletqfnlvhgsds
aesaqreialwfpga
SCOP Domain Coordinates for d1k44b_:
Click to download the PDB-style file with coordinates for d1k44b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1k44b_:
- d1k44b_ is new in SCOP 1.61
- d1k44b_ appears in SCOP 1.63
- d1k44b_ appears in the current release, SCOPe 2.08
View in 3D
