SCOP 1.61: Domain d1k42a_: 1k42 A:

Lineage for d1k42a_ (1k42 A:)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)

4. Superfamily b.18.1: Galactose-binding domain-like [49785] (15 families)

5. Family b.18.1.14: CBM4 [74893] (1 protein)

6. Protein Carbohydrate binding module from a thermostable xylanase [74894] (1 species)

7. Species Rhodothermus marinus [TaxId:29549] [74895] (2 PDB entries)

8. Domain d1k42a_: 1k42 A: [72032]

Details for d1k42a_

PDB Entry: 1k42

PDB Description: the solution structure of the cbm4-2 carbohydrate binding module from a thermostable rhodothermus marinus xylanase.

SCOP Domain Sequences for d1k42a_:

Sequence; same for both SEQRES and ATOM records:

>d1k42a_ b.18.1.14 (A:) Carbohydrate binding module from a thermostable xylanase {Rhodothermus marinus}
mlvaninggfestpagvvtdlaegvegwdlnvgssvtnppvfevletsdapegnkvlavt
vngvgnnpwdieatafpvnvrpgvtytytiwaraeqdgavvsftvgnqsfqeygrlheqq
ittewqpftfeftvsdqetvirapihfgyaanvgntiyidglaiasqp

Timeline for d1k42a_:

• d1k42a_ is new in SCOP 1.61
  
• d1k42a_ appears in SCOP 1.63
  
• d1k42a_ appears in the current release, SCOPe 2.08, called d1k42a1