Lineage for d1k3ua_ (1k3u A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2435328Superfamily c.1.2: Ribulose-phoshate binding barrel [51366] (7 families) (S)
  5. 2435860Family c.1.2.4: Tryptophan biosynthesis enzymes [51381] (4 proteins)
  6. 2435890Protein Trp synthase alpha-subunit [51388] (8 species)
  7. 2435939Species Salmonella typhimurium [TaxId:90371] [51389] (65 PDB entries)
  8. 2435952Domain d1k3ua_: 1k3u A: [72030]
    Other proteins in same PDB: d1k3ub_
    complexed with iad, na, plp

Details for d1k3ua_

PDB Entry: 1k3u (more details), 1.7 Å

PDB Description: crystal structure of wild-type tryptophan synthase complexed with n- [1h-indol-3-yl-acetyl]aspartic acid
PDB Compounds: (A:) tryptophan synthase alpha chain

SCOPe Domain Sequences for d1k3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3ua_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]}
meryenlfaqlndrregafvpfvtlgdpgieqslkiidtlidagadalelgvpfsdplad
gptiqnanlrafaagvtpaqcfemlalirekhptipigllmyanlvfnngidafyarceq
vgvdsvlvadvpveesapfrqaalrhniapificppnadddllrqvasygrgytyllsrs
gvtgaenrgalplhhlieklkeyhaapalqgfgisspeqvsaavragaagaisgsaivki
ieknlaspkqmlaelrsfvsamkaasra

SCOPe Domain Coordinates for d1k3ua_:

Click to download the PDB-style file with coordinates for d1k3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1k3ua_: