Lineage for d1k3td2 (1k3t D:165-333)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1915719Fold d.81: FwdE/GAPDH domain-like [55346] (4 superfamilies)
    core: alpha-beta-alpha-beta(3); mixed sheet: 2134, strand 2 is parallel to strand 1
  4. 1915720Superfamily d.81.1: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain [55347] (5 families) (S)
    N-terminal domain is the classic Rossmann-fold
  5. 1915721Family d.81.1.1: GAPDH-like [55348] (6 proteins)
    has many additional secondary structures
  6. 1915812Protein Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) [55349] (19 species)
  7. 1916010Species Trypanosoma cruzi [TaxId:5693] [75483] (5 PDB entries)
  8. 1916018Domain d1k3td2: 1k3t D:165-333 [72029]
    Other proteins in same PDB: d1k3ta1, d1k3tb1, d1k3tc1, d1k3td1
    complexed with brz

Details for d1k3td2

PDB Entry: 1k3t (more details), 1.95 Å

PDB Description: Structure of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase from Trypanosoma cruzi Complexed with Chalepin, a Coumarin Derivative Inhibitor
PDB Compounds: (D:) glyceraldehyde-3-phosphate dehydrogenase

SCOPe Domain Sequences for d1k3td2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k3td2 d.81.1.1 (D:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]}
scttnclapivhvlvkegfgvqtglmttihsytatqktvdgvsvkdwrggraaavniips
ttgaakavgmvipstqgkltgmsfrvptpdvsvvdltftaardtsiqeidaalkraskty
mkgilgytdeelvsadfindnrssiydskatlqnnlpkerrffkivswy

SCOPe Domain Coordinates for d1k3td2:

Click to download the PDB-style file with coordinates for d1k3td2.
(The format of our PDB-style files is described here.)

Timeline for d1k3td2: